PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00650g06001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 147aa    MW: 16808.2 Da    PI: 9.8342
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00650g06001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.82.1e-091001332255
                               SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                  Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                                +yp++ ++  LA+++gL+ +q+ +WF N+R ++
  Niben101Scf00650g06001.1 100 WPYPTEGDKNSLAESTGLDPKQINNWFINQRKRH 133
                               58*****************************985 PP

2ELK32.71.6e-115374122
                       ELK  1 ELKhqLlrKYsgyLgsLkqEFs 22
                              ELK++LlrK++++L+sLk EFs
  Niben101Scf00650g06001.1 53 ELKDRLLRKFGSHLSSLKLEFS 74
                              9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF037894.4E-85374IPR005539ELK domain
PROSITE profilePS5121310.1965373IPR005539ELK domain
SMARTSM011888.4E-65374IPR005539ELK domain
PROSITE profilePS5007112.61773136IPR001356Homeobox domain
SuperFamilySSF466897.7E-2074143IPR009057Homeodomain-like
SMARTSM003891.0E-1275140IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.609.9E-2978137IPR009057Homeodomain-like
CDDcd000862.63E-1185137No hitNo description
PfamPF059205.1E-1893132IPR008422Homeobox KN domain
PROSITE patternPS000270111134IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    Send to blast
MTLGVCRILR KGCILADPAG AVTILRSPND GGVSSDEELS CGEAEGQRNE DNELKDRLLR  60
KFGSHLSSLK LEFSKKKKKG KLPKQARQML LAWWNDHYRW PYPTEGDKNS LAESTGLDPK  120
QINNWFINQR KRHWKPSENM QLAVMDN
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016490194.11e-73PREDICTED: homeobox protein knotted-1-like 6
SwissprotQ84JS67e-55KNAT6_ARATH; Homeobox protein knotted-1-like 6
TrEMBLQ9SXV43e-69Q9SXV4_TOBAC; Homeobox 22
STRINGPGSC0003DMT4000350951e-66(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7532480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.12e-45KNOTTED1-like homeobox gene 6